DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp14

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001006060.1 Gene:dusp14 / 450040 ZFINID:ZDB-GENE-041010-162 Length:221 Species:Danio rerio


Alignment Length:152 Identity:60/152 - (39%)
Similarity:87/152 - (57%) Gaps:9/152 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VFPHLLLGNGRDADDPS---SVGANCVLNVTCQSPNES--HLQGLKYMQIPASDTPHQNIKQYFQ 196
            :.|.|.||.|..|.:.|   |.|..||:|.|.:.||.:  |::   |:::|.:|.||..|..||.
Zfish    53 ITPSLFLGRGNVASNRSLLLSKGITCVVNATIELPNFNWPHME---YVKVPLADMPHSPISLYFD 114

  Fly   197 EAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMG 261
            ...|.|....:....||:||.||:||||::.:||:|:|..:||.||:..||..||:|.||..|..
Zfish   115 SVADKIHSVGRKRGAVLVHCAAGVSRSASLCLAYLMKYHRVSLAEAHAWVKARRPVIRPNGGFWR 179

  Fly   262 QLLELEQNL-RKSGVLAPATPH 282
            ||:|.|:.| .::.|....||:
Zfish   180 QLIEYERKLFGRNSVKMIQTPY 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 55/134 (41%)
CDC14 <193..272 CDD:225297 35/79 (44%)
dusp14NP_001006060.1 DSPc 49..185 CDD:238073 55/134 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.