DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and styxl1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001004619.1 Gene:styxl1 / 447880 ZFINID:ZDB-GENE-040912-45 Length:295 Species:Danio rerio


Alignment Length:162 Identity:40/162 - (24%)
Similarity:70/162 - (43%) Gaps:17/162 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 RSCSSPAVYDIETHPASPVFPHLLLGNGRDADD---PSSVGANCVLNVTCQSPNESHL----QGL 176
            |...|..:|.:|..|.     .|.:|:.|.|.:   ...:..|.::||:    |:..|    ...
Zfish   133 RELESLNLYPVEILPG-----QLYMGDYRQATNLKVLKDLKLNAIVNVS----NDCSLIFKKANC 188

  Fly   177 KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLE 241
            ..:.|..:|:...::...|:....||.......|.||:....|.||...:|:||:|.:...::.|
Zfish   189 TVLHIRVADSAEADLVTSFERICVFINSHLNNASSVLVFSTLGKSRCCAVAMAYLMSHLKYTIKE 253

  Fly   242 AYKLVKVARPIISPNLNFMGQLLELE-QNLRK 272
            |:..::..:..:.||..|:.||.:.| |.|.|
Zfish   254 AWNHIQQCKANMRPNRGFVQQLSDWELQTLGK 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 32/140 (23%)
CDC14 <193..272 CDD:225297 23/79 (29%)
styxl1NP_001004619.1 RHOD 33..121 CDD:294087
PTPc 142..279 CDD:304379 33/145 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.