DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp2

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001003451.1 Gene:dusp2 / 445057 ZFINID:ZDB-GENE-040801-188 Length:333 Species:Danio rerio


Alignment Length:184 Identity:69/184 - (37%)
Similarity:96/184 - (52%) Gaps:25/184 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 STTSSSTAMNGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSV---GANCVL 161
            ||.|....:..|.:||          :|| :..|.. :.|.|.||:...:....::   |...||
Zfish   157 STLSEPEPVMSGRKTP----------LYD-QGGPVE-ILPFLFLGSAHHSSRRETLERNGITAVL 209

  Fly   162 NVTCQSPN--ESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSA 224
            ||:...||  |..||   |..:...|:...:|:..|.||..||:..::.|.|||:||.|||||||
Zfish   210 NVSSSCPNLFEEELQ---YKTLKVEDSLAADIRVLFPEAIHFIDSIKEGGGRVLVHCQAGISRSA 271

  Fly   225 TIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAP 278
            ||.:||::..:.:.|.||:..||..|.:|||||.||||||:.|     :.||.|
Zfish   272 TICLAYLIHAQRVRLDEAFDFVKRRRQVISPNLAFMGQLLQFE-----TDVLCP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 57/138 (41%)
CDC14 <193..272 CDD:225297 40/78 (51%)
dusp2NP_001003451.1 DSP_MapKP 8..145 CDD:238723
DSPc 178..314 CDD:238073 57/139 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.