DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Mkp

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001036572.1 Gene:Mkp / 4379907 FlyBaseID:FBgn0083992 Length:203 Species:Drosophila melanogaster


Alignment Length:203 Identity:60/203 - (29%)
Similarity:88/203 - (43%) Gaps:31/203 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YPNKRSRENLACDEVTSTTSSSTAMNGGGRTPALTRSCSSPAVYDI------------------- 129
            |..:|...||.......||.:....        :.||.||..|.||                   
  Fly     5 YELQRRMGNLRPTATVVTTPTGVRY--------IERSTSSVCVEDIAHCSQQLDPREYGFVVDTK 61

  Fly   130 -ETHPASPVFPHLLLG--NGRDADDPSSVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNI 191
             ::.||..:...|.||  :...||:........:|:|..|:|.......:....:|..|.|..|:
  Fly    62 PDSVPACILSDFLYLGSQDAVSADNIIKYKITHILSVGIQTPEVEWPLPVNCTFLPCLDLPETNL 126

  Fly   192 KQYFQEA-YDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISP 255
            ..|...| .:|||||.::...||:||:||:|||.::.|.|:|:.:.:...:||.|||..||.|.|
  Fly   127 MNYILPASMEFIEDAHRSQGCVLVHCNAGVSRSPSVVIGYLMQRRDMCYEDAYNLVKSWRPCIQP 191

  Fly   256 NLNFMGQL 263
            |..|:.||
  Fly   192 NAGFIQQL 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 47/134 (35%)
CDC14 <193..272 CDD:225297 32/72 (44%)
MkpNP_001036572.1 DSPc 66..200 CDD:238073 47/134 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462491
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.