DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and PTPMT1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_651180.3 Gene:PTPMT1 / 42807 FlyBaseID:FBgn0039111 Length:200 Species:Drosophila melanogaster


Alignment Length:165 Identity:37/165 - (22%)
Similarity:69/165 - (41%) Gaps:41/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 VYDIETHPASP------VFPHLLLG------NGRDADDPSSVGANCVLN----VTCQSPNESHLQ 174
            :|::....||.      :..|::||      ...|..:..::.|...:|    :|..|.|....:
  Fly    18 LYNVLMEKASARNWYDRIDEHVILGALPFRSQANDLIEKENMKAVVSMNEDYELTAFSNNTEKWR 82

  Fly   175 --GLKYMQIPASD---TPHQNIKQYFQEAYDFIE----------------DARKTGSRVLLHCHA 218
              |::::|:..:|   :|:|  ::.|: ..:||.                .....|| |.:||.|
  Fly    83 KLGIEFLQLATTDIFESPNQ--EKLFR-GVEFINKFLPLKQRIGGLSSSYQPENVGS-VYVHCKA 143

  Fly   219 GISRSATIAIAYVMRYKSLSLLEAYKLVKVARPII 253
            |.:||||:...|:|.....:..:|...::..||.|
  Fly   144 GRTRSATLVGCYLMMKNGWTPDQAVDHMRKCRPHI 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 36/158 (23%)
CDC14 <193..272 CDD:225297 20/77 (26%)
PTPMT1NP_651180.3 PTPMT1 31..194 CDD:350374 34/152 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462488
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.