DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_998232.1 Gene:dusp1 / 406340 ZFINID:ZDB-GENE-040426-2018 Length:360 Species:Danio rerio


Alignment Length:411 Identity:108/411 - (26%)
Similarity:150/411 - (36%) Gaps:154/411 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SVSHIQSEMKMRI-----KREAPCLLLFMPIQNTNNNNRI------------------GANQKD- 83
            |||||.....:|.     :|....|.|...:.|.:..||:                  |..:|| 
Zfish    37 SVSHISGSSNVRFSTIVRRRARGGLGLEHIVPNEDTRNRLLSGEYQSVVFLDDHSLEMGEVKKDG 101

  Fly    84 -------------------------------YPNKRSR----ENLACDEVTSTTSSSTAMNGGGR 113
                                           :|.|.::    :.|:. .::|...|:||      
Zfish   102 TLMLAVNALCRKQCGASVYLLKGGFDTFSAEFPEKCTKTVPPQGLSL-PLSSNCHSNTA------ 159

  Fly   114 TPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDA---DDPSSVGANCVLNVTCQSPN--ESHL 173
             .:...:|::| :|| :..|.. :.|.|.||:...|   |....:|...::||:...||  |.|.
Zfish   160 -DSSCNTCTTP-LYD-QGGPVE-ILPFLYLGSAYHASRKDMLDMLGITALINVSSNCPNHFEDHY 220

  Fly   174 QGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLS 238
            |   |..||..|....||..:|.||.:||:..|..|.||.:||.|||||||||.:||:||...:.
Zfish   221 Q---YKSIPVEDNHKANISSWFNEAIEFIDSVRNKGGRVFVHCQAGISRSATICLAYLMRTNRVK 282

  Fly   239 LLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSSSSVGLSTQSSQL 303
            |.||::.||..|.|||||.:||||||:.|..:                                 
Zfish   283 LEEAFEFVKQRRSIISPNFSFMGQLLQFESQV--------------------------------- 314

  Fly   304 VEQPEEEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAGSNCSSRLTSPPITPDDEAPS- 367
                                                     ||.|.|||...||.|..:....: 
Zfish   315 -----------------------------------------LASSTCSSEAGSPAIGKNSTVFNF 338

  Fly   368 -TSAAASSVSELDSPSSTSSS 387
             ...|||.:|.|.||.:||.|
Zfish   339 PVHTAASPLSFLQSPITTSPS 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 62/138 (45%)
CDC14 <193..272 CDD:225297 42/78 (54%)
dusp1NP_998232.1 DSP_MapKP 8..137 CDD:238723 16/99 (16%)
DSPc 175..311 CDD:238073 62/139 (45%)
CDC14 <225..326 CDD:225297 53/174 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.