DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and CG10089

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001261803.1 Gene:CG10089 / 39517 FlyBaseID:FBgn0036369 Length:447 Species:Drosophila melanogaster


Alignment Length:456 Identity:111/456 - (24%)
Similarity:165/456 - (36%) Gaps:167/456 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VFPHLLLGNGRDADDPSSVGANCVLNVTC--QSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAY 199
            |.|.|.:||.||:.|.:.:....:.::..  .||... |....|:.:.|||||.||:.|||....
  Fly     8 VLPGLYVGNYRDSKDHAQLERFKISHIIAIHDSPRRL-LPDKHYLCVMASDTPDQNLSQYFSVCN 71

  Fly   200 DFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLL 264
            |||..||.....||:||.||:|||.|:|:||:|....|:..||.|:|:..|.:.:||..|..||.
  Fly    72 DFIHAARLREGNVLIHCLAGMSRSVTVAVAYIMTATHLNWKEALKVVRAGRAVANPNAGFQSQLQ 136

  Fly   265 ELEQ--------NLRK-------------------------------------------SGVL-- 276
            |.||        .||:                                           :||.  
  Fly   137 EFEQFKLSEERRRLRERFPSSALEQLDRTKVATALDNYQELLQNRDICEGNCSRGEKCPTGVCNM 201

  Fly   277 -----------APATPH-----LNSPSNPSSSSVGLSTQSSQ----------------------- 302
                       :.|:.|     .:|.:|.||||:.:|:.::|                       
  Fly   202 DPTKGLFRRRPSNASTHSRLRAQSSNANASSSSLSVSSAAAQSCPTSPKNSPLPIVRRSVGNERI 266

  Fly   303 -----LVEQPE-------------EEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAGSN 349
                 ::|||.             |:.:|||.:|...:..                   .|:.|.
  Fly   267 PEDEIVLEQPPTTSREAAEYAAAFEDARREQEQRQLQQQQ-------------------QLSRSQ 312

  Fly   350 CSSRLTSPPITPDDEAPSTSAAAS----------SVSELDSPSST---------SSSSGICSLLQ 395
            .|.|    |:....|||..|:|.|          ..::|...:||         ||.:|:.:...
  Fly   313 RSPR----PVNSSREAPRVSSAGSRRESAAREGNGSAQLQRSASTVSGFGVRPRSSPAGLHAYTG 373

  Fly   396 STSSSVSPRAISKPNLLSPTRQLALF-----KRNSPAKLRLDLESSYAPASPIPNTMPWLSVPST 455
            |..|||..   |:.:|....:..|::     .|.|...:.....||...|.|.|...|    |::
  Fly   374 SVPSSVHG---SRVDLRDADKGSAIYLGCSAPRASTLSISSSRGSSGGSAPPSPCHTP----PAS 431

  Fly   456 P 456
            |
  Fly   432 P 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 53/131 (40%)
CDC14 <193..272 CDD:225297 37/86 (43%)
CG10089NP_001261803.1 DSPc 4..139 CDD:238073 53/131 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45462489
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm9172
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.