DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp14l1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_003749325.1 Gene:Dusp14l1 / 365977 RGDID:1590821 Length:198 Species:Rattus norvegicus


Alignment Length:128 Identity:57/128 - (44%)
Similarity:77/128 - (60%) Gaps:2/128 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 GANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGI 220
            |..||:|.|.:.||.:..| .:|:::|.:|.||..|:.||....|.|....|.....|:||.||:
  Rat    52 GITCVVNATIEIPNFNWPQ-FEYVKVPLADIPHAPIRLYFDTVADKIHSVSKKHGATLVHCAAGV 115

  Fly   221 SRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL-RKSGVLAPATPH 282
            |||||:.|||:|::.:|.|||||..||..||:|.|||.|..||::.|..| .||.|....||:
  Rat   116 SRSATLCIAYLMKFHNLCLLEAYNWVKARRPVIRPNLGFWRQLIDYESQLFGKSSVKMVQTPY 178

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 50/110 (45%)
CDC14 <193..272 CDD:225297 38/79 (48%)
Dusp14l1XP_003749325.1 DSPc 26..162 CDD:238073 50/110 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.