DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Ssh3

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_038941418.1 Gene:Ssh3 / 365396 RGDID:1308679 Length:697 Species:Rattus norvegicus


Alignment Length:214 Identity:63/214 - (29%)
Similarity:93/214 - (43%) Gaps:38/214 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ASPVFPHLLLGNGRDADDPSSVGANCV---LNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYF 195
            ||.:||||.||:..:|.:...:..|.|   ||:..:..| ...:...|..:...|.....:..::
  Rat   355 ASRIFPHLYLGSEWNAANLEELQRNRVSHILNMAREIDN-FFPERFTYHNVRVWDEESAQLLPHW 418

  Fly   196 QEAYDFIEDA----------------RKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYK 244
            :|.:.|||||                |..|:|||:||..|:||||...:||.|:.....|.:|..
  Rat   419 KETHRFIEDARLLGLKGNGLTISHLHRAQGTRVLVHCKMGVSRSAATVLAYAMKQYGWGLEQALI 483

  Fly   245 LVKVARPIISPNLNFMGQLLELEQNL----------RKSGVLAP--------ATPHLNSPSNPSS 291
            .|:..|||:.||..|:.||...:..|          :|.||::|        :||....|..|..
  Rat   484 HVQELRPIVRPNPGFLRQLQTYQGILTASRQSHVWEQKVGVVSPEEPLAPEVSTPLPPLPPEPGG 548

  Fly   292 SSVGLSTQSSQLVEQPEEE 310
            |..|:........|.|:||
  Rat   549 SGEGMVMGQKGSQETPKEE 567

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 48/151 (32%)
CDC14 <193..272 CDD:225297 33/104 (32%)
Ssh3XP_038941418.1 SSH-N 32..279 CDD:212166
DEK_C 298..349 CDD:400903
DSP_slingshot_3 352..511 CDD:350419 49/156 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.