DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp29

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001101838.1 Gene:Dusp29 / 361003 RGDID:1310229 Length:215 Species:Rattus norvegicus


Alignment Length:194 Identity:54/194 - (27%)
Similarity:92/194 - (47%) Gaps:32/194 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPAVYDIE----------THPASPVFPHLLLGNGRDADDP---SSVGANCVLNV------TCQSP 168
            :|..:::|          || .:.|:|.|.:|:...|.|.   ...|...|||.      ....|
  Rat    34 TPGAFELERLFWKGSPQYTH-VNEVWPRLHVGDEATALDRYGLQKAGFTHVLNAAHGRWNVDTGP 97

  Fly   169 NESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDA-RKTGSRVLLHCHAGISRSATIAIAYVM 232
            :......::|..:.|.|.|..::..:|..|..||:.| :...|::|:||..|.|||||:.:||:|
  Rat    98 DYYRDMAIEYHGVEADDVPTFDLSIFFYSAAAFIDSALQDDHSKILVHCAMGRSRSATLVLAYLM 162

  Fly   233 RYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSSSSVGL 296
            .:|:::|::|.:.|...|.:: ||..|:.||.||::.|.|.          ...:.|.:..:||
  Rat   163 IHKNMTLVDAIQQVAKNRCVL-PNRGFLKQLRELDKQLVKQ----------RRQAGPGAGELGL 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 44/143 (31%)
CDC14 <193..272 CDD:225297 31/79 (39%)
Dusp29NP_001101838.1 DSPc 53..196 CDD:238073 45/144 (31%)
Substrate binding. /evidence=ECO:0000250|UniProtKB:Q68J44 145..152 3/6 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.