DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp13

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_008768696.2 Gene:Dusp13 / 361002 RGDID:1359712 Length:391 Species:Rattus norvegicus


Alignment Length:152 Identity:54/152 - (35%)
Similarity:83/152 - (54%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 THPASPVFPHLLLGNGRDADDPS---SVGANCVLNVTC----QSPNESHLQG--LKYMQIPASDT 186
            || .:.|:|:|.||:...|.|.|   .:|...|:||..    ........:|  ::|..|.|.|.
  Rat   237 TH-INEVWPNLFLGDAYAARDKSRLIQLGITHVVNVAAGKFQVDTGAKFYRGTPVEYYGIEADDN 300

  Fly   187 PHQNIKQYFQEAYDFIEDARKT-GSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVAR 250
            |..::..||.....:|.||..| .||||:||..|:||||||.:|::|.:::::|::|.:.|:..|
  Rat   301 PFFDLSVYFLPVARYIRDALNTPRSRVLVHCAMGVSRSATIVLAFLMIFENMTLVDAIQTVQAHR 365

  Fly   251 PIISPNLNFMGQLLELEQNLRK 272
            . |.||..|:.||..|:..||:
  Rat   366 D-ICPNSGFLRQLQVLDNRLRR 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 49/143 (34%)
CDC14 <193..272 CDD:225297 33/79 (42%)
Dusp13XP_008768696.2 PTP_DSP_cys 221..384 CDD:421693 52/148 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.