DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and DUSP29

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001003892.1 Gene:DUSP29 / 338599 HGNCID:23481 Length:220 Species:Homo sapiens


Alignment Length:230 Identity:60/230 - (26%)
Similarity:98/230 - (42%) Gaps:67/230 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPAVYDIE----------THPASPVFPHLLLGNGRDADDP---SSVGANCVLNV------TCQSP 168
            :|..:::|          || .:.|:|.|.:|:...|.|.   ...|...|||.      ....|
Human    35 TPGAFELERLFWKGSPQYTH-VNEVWPKLYIGDEATALDRYRLQKAGFTHVLNAAHGRWNVDTGP 98

  Fly   169 NESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTG-SRVLLHCHAGISRSATIAIAYVM 232
            :......::|..:.|.|.|..::..:|..|..||:.|.... |::|:||..|.|||||:.:||:|
Human    99 DYYRDMDIQYHGVEADDLPTFDLSVFFYPAAAFIDRALSDDHSKILVHCVMGRSRSATLVLAYLM 163

  Fly   233 RYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSSSSVGLS 297
            .:|.::|::|.:.|...|.:: ||..|:.||.||::                             
Human   164 IHKDMTLVDAIQQVAKNRCVL-PNRGFLKQLRELDK----------------------------- 198

  Fly   298 TQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDG 332
                |||:|    .:|.||:.|:        :|||
Human   199 ----QLVQQ----RRRSQRQDGE--------EEDG 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 44/143 (31%)
CDC14 <193..272 CDD:225297 30/79 (38%)
DUSP29NP_001003892.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..29
DUPD1 45..201 CDD:350423 48/190 (25%)
Substrate binding. /evidence=ECO:0000305 146..153 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.