DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and CG7378

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster


Alignment Length:183 Identity:55/183 - (30%)
Similarity:93/183 - (50%) Gaps:29/183 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PALTRS-CSSPAVYDIETHPASPVFPHLLLGNGRDADDPS---SVGANCVLNVT--CQ------- 166
            |.|.|: |   |::|::   ...|:|.:.:|:...|.:.:   .:|...|||..  |:       
  Fly    57 PGLRRAEC---AIHDVD---CDEVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTG 115

  Fly   167 --------SPNESHLQGL-KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISR 222
                    |...||...: :||..|..|.|..:|.:||..|..||:.|..:|.::|:||..|:||
  Fly   116 HSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSR 180

  Fly   223 SATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGV 275
            |||..:||:|..:.:|.::|.:.|::.|. |.||..|:.||.:|:..|::..:
  Fly   181 SATCVLAYLMICRKMSAVDAIRTVRMRRD-IRPNDGFLQQLADLDMELKRKNL 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 47/154 (31%)
CDC14 <193..272 CDD:225297 31/78 (40%)
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 48/156 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 44 1.000 Domainoid score I728
eggNOG 1 0.900 - - E2759_KOG1716
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.