DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp2

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001012089.1 Gene:Dusp2 / 311406 RGDID:1305804 Length:318 Species:Rattus norvegicus


Alignment Length:179 Identity:70/179 - (39%)
Similarity:97/179 - (54%) Gaps:15/179 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 CDEVTSTTSSSTAMNGGGRTPALTRSCSSPAV--YDIETHPASPVFPHLLLGNGRDADDPSSV-- 155
            |.::.|...:......|..     .:.|.|.|  || :..|.. :.|:|.||:...:.|...:  
  Rat   143 CPDLCSEAPAQALPPAGAE-----NNSSDPRVPIYD-QGGPVE-ILPYLYLGSCNHSSDLQGLQA 200

  Fly   156 -GANCVLNVTCQSPNESHLQGL-KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHA 218
             |...||||:...||  |.:|| :|..||..|.....|..:||||..||:..:.:|.|||:||.|
  Rat   201 CGITAVLNVSASCPN--HFEGLFRYKSIPVEDNQMVEISAWFQEAIGFIDSVKNSGGRVLVHCQA 263

  Fly   219 GISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELE 267
            ||||||||.:||:::...:.|.||:..||..|.:||||.:||||||:||
  Rat   264 GISRSATICLAYLIQSHRVRLDEAFDFVKQRRGVISPNFSFMGQLLQLE 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 60/137 (44%)
CDC14 <193..272 CDD:225297 41/75 (55%)
Dusp2NP_001012089.1 DSP_MapKP 12..147 CDD:238723 1/3 (33%)
DSPc 176..312 CDD:238073 60/138 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.