DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp9

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001033062.1 Gene:Dusp9 / 293847 RGDID:1565535 Length:414 Species:Rattus norvegicus


Alignment Length:325 Identity:95/325 - (29%)
Similarity:147/325 - (45%) Gaps:76/325 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NGRCE---------------CDGDGDSVSHIQSEMKMRIKREAPCLLLFMPIQNTNNNNRIG--- 78
            :|:|:               .:.:.::.:..::|.|...|.||         :..:.::.:|   
  Rat    85 SGQCQPEATEAEAKAEAEAKAEAEAEAKAEAEAEAKAEAKEEA---------EEWDADSVLGILL 140

  Fly    79 --ANQKDYP-----NKRSRENLACDEVTSTTSSSTAMNGGGR----TPAL--------------- 117
              ..::.||     ...|:....|..:..|:.|..|.:|.|.    .|.:               
  Rat   141 QKLREEGYPAYYLQGGFSKFQAECPHLCETSFSGRAGSGLGSMSSPVPVVGLGGLCLSTDFSDAE 205

  Fly   118 ------TRSC-------SSPAVYDIETHPASPVFPHLLLGNGRDA---DDPSSVGANCVLNVTCQ 166
                  |.||       :||....:...||. :.|:|.||:.||:   :..:.:|...:||||..
  Rat   206 SEADRDTLSCGLDSESTTSPPAGLLPPFPAQ-ILPNLYLGSARDSANLESLAKLGIRYILNVTPN 269

  Fly   167 SPNESHLQG-LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAY 230
            .||.....| ..|.|||.||...||:.|:|.||..||::|......||:||.||:|||.|:.:||
  Rat   270 LPNLFEKNGDFHYKQIPISDHWSQNLSQFFPEAIAFIDEALSQNCGVLVHCLAGVSRSVTVTVAY 334

  Fly   231 VMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLR----KSGVLAPATPHLNSPSNPSS 291
            :|:..:|||.:||.|||..:..||||.|||||||:.|::||    :||......|. ::.|:|.|
  Rat   335 LMQKLNLSLNDAYDLVKRKKSNISPNFNFMGQLLDFERSLRLGEKRSGGRGSGGPE-STVSDPPS 398

  Fly   292  291
              Rat   399  398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 63/137 (46%)
CDC14 <193..272 CDD:225297 42/82 (51%)
Dusp9NP_001033062.1 DSP_MapKP 5..168 CDD:238723 12/91 (13%)
DSPc 234..371 CDD:238073 63/137 (46%)
CDC14 <254..372 CDD:225297 55/117 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.