DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and SPBC17A3.06

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_595588.1 Gene:SPBC17A3.06 / 2540146 PomBaseID:SPBC17A3.06 Length:330 Species:Schizosaccharomyces pombe


Alignment Length:160 Identity:51/160 - (31%)
Similarity:82/160 - (51%) Gaps:21/160 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 YDIETHPASPVFPHLLLGNGRDADD---PSSVGANCVLNVTCQSPN-----ESHLQGLKYMQIPA 183
            |....:..|.:..:|.:.:.:.|.:   .|..|.:..|:....:||     :.||    ::||  
pombe    40 YPDSLNDLSEISKNLYISSWKTASELVSTSDKGIDYTLSAMSINPNLSVPEQQHL----WLQI-- 98

  Fly   184 SDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKV 248
            .|:..|||.|||:::..||..|....::||:||.||||||.|:..||:|:..:.:..||...:..
pombe    99 EDSSSQNILQYFEKSNKFIAFALSKNAKVLVHCFAGISRSVTLVAAYLMKENNWNTEEALSHINE 163

  Fly   249 ARPIISPNLNFMGQL-------LELEQNLR 271
            .|..||||.||:.||       .:|:::||
pombe   164 RRSGISPNANFLRQLRVYFECNYQLDRSLR 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 47/148 (32%)
CDC14 <193..272 CDD:225297 34/86 (40%)
SPBC17A3.06NP_595588.1 CDC14 18..201 CDD:225297 51/160 (32%)
DSPc 47..181 CDD:238073 47/139 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.