DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp5

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001078859.1 Gene:Dusp5 / 240672 MGIID:2685183 Length:384 Species:Mus musculus


Alignment Length:234 Identity:82/234 - (35%)
Similarity:116/234 - (49%) Gaps:34/234 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YPNKRSRENLACDEVTSTTSSSTAMNGGGRTPALTRSCSSPAVYDIETHPA----SPV--FPHLL 142
            ||.       .|.:|..|:.....   |.|  :|...|..| |..:...||    .||  .|.|.
Mouse   136 YPE-------CCVDVKPTSQEKIE---GER--SLLSQCGKP-VLSVAYRPAYDQGGPVEILPFLY 187

  Fly   143 LGNGRDA---DDPSSVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIED 204
            ||:...|   :..:::....:|||: :..:|:....|.|..||..|:...:|..:||||.|||:.
Mouse   188 LGSAYHASKCEFLANLHITALLNVS-RRTSEACTTHLHYKWIPVEDSHTADISSHFQEAIDFIDC 251

  Fly   205 ARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQN 269
            .|:.|.:||:||.||:|||.||.:||:|:.|...|.||:..||..|.::|||..||||||:.|..
Mouse   252 VREEGGKVLVHCEAGVSRSPTICMAYLMKTKQFRLKEAFDYVKQRRSVVSPNFGFMGQLLQYESE 316

  Fly   270 LRKSGVLAPATPHLNSPS----NPSSSSVG-LSTQSSQL 303
                  :.|:||.|..||    ..||:.:| |.|.|..:
Mouse   317 ------ILPSTPTLQPPSCQGEAASSTFIGHLQTLSPDM 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 58/142 (41%)
CDC14 <193..272 CDD:225297 40/78 (51%)
Dusp5NP_001078859.1 DSP_MapKP 5..140 CDD:238723 2/10 (20%)
DSPc 178..314 CDD:238073 56/136 (41%)
CDC14 <227..318 CDD:225297 44/96 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.