DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Dusp1

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_038670.1 Gene:Dusp1 / 19252 MGIID:105120 Length:367 Species:Mus musculus


Alignment Length:222 Identity:83/222 - (37%)
Similarity:117/222 - (52%) Gaps:34/222 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ACDEVTSTTSSSTAMNGGGRTPALT----------RSCSSPAVYDIETHPASPVFPHLLLGNGRD 148
            :|.|:.|..|:.|.::    .|..|          .|||:| :|| :..|.. :...|.||:...
Mouse   131 SCPELCSKQSTPTGLS----LPLSTSVPDSAESGCSSCSTP-LYD-QGGPVE-ILSFLYLGSAYH 188

  Fly   149 A---DDPSSVGANCVLNVTCQSPNESHLQG-LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTG 209
            |   |...::|...::||:...||  |.:| .:|..||..|....:|..:|.||.|||:..:..|
Mouse   189 ASRKDMLDALGITALINVSANCPN--HFEGHYQYKSIPVEDNHKADISSWFNEAIDFIDSIKDAG 251

  Fly   210 SRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSG 274
            .||.:||.|||||||||.:||:||...:.|.||::.||..|.|||||.:||||||:.|     |.
Mouse   252 GRVFVHCQAGISRSATICLAYLMRTNRVKLDEAFEFVKQRRSIISPNFSFMGQLLQFE-----SQ 311

  Fly   275 VLAPATPHLNSPSNPSSSSV---GLST 298
            |||   ||.::.:...:.:|   |.||
Mouse   312 VLA---PHCSAEAGSPAMAVLDRGTST 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 59/137 (43%)
CDC14 <193..272 CDD:225297 42/78 (54%)
Dusp1NP_038670.1 DSP_MapKP 7..136 CDD:238723 2/4 (50%)
DSPc 173..309 CDD:238073 59/138 (43%)
CDC14 188..313 CDD:225297 57/131 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.