DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and ZK757.2

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_499190.2 Gene:ZK757.2 / 191421 WormBaseID:WBGene00014074 Length:294 Species:Caenorhabditis elegans


Alignment Length:337 Identity:87/337 - (25%)
Similarity:134/337 - (39%) Gaps:100/337 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   122 SSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCV-LNV----TCQSPNESHLQGLKYMQI 181
            :|..:.:.|....|.:.|:|.: :|..|..|..:...|| :|:    ...:|..     :|.:.:
 Worm     2 TSRRIINREQRQCSQIRPYLYV-SGLAALSPRVLSRFCVCINLIPGFRLSAPPH-----MKVVHL 60

  Fly   182 PASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLV 246
            |..|....::..::...|..||:|||...|.||.|..|||||||..|||||:|:..:|.::||.|
 Worm    61 PLQDNETTDLSPHWANVYKEIEEARKGAGRALLLCAMGISRSATFGIAYVMQYEKKTLHDSYKAV 125

  Fly   247 KVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPSNPSSSSVGLSTQSSQLVEQ----- 306
            ::||.||.||:.|..||::|||.||                         ...|.:::|.     
 Worm   126 QLARNIICPNVGFFQQLIDLEQKLR-------------------------GKVSCKIIEPLPGCK 165

  Fly   307 -PEE--EEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAGSNCSSRLTSPPITPDDEAPST 368
             |:.  :|..::.....|:.|..                 |||..|.|:|             ||
 Worm   166 VPDVIWQELYDEMIMSMSQDDRH-----------------SLASCNLSAR-------------ST 200

  Fly   369 SAAASSVSELDSPSSTSSSSGICSLLQSTSSSVSPRAI-SKPNLLSPTRQLALFKRNSPAKLRLD 432
            :....|:..|:..:.||.|        ..|..::.|.| :.|.||.|:.                
 Worm   201 TNDTMSLRSLNMVNDTSRS--------LASFHLTHRPIGASPTLLVPSS---------------- 241

  Fly   433 LESSYAPASPIP 444
             .||.:...|||
 Worm   242 -SSSSSVRGPIP 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 49/138 (36%)
CDC14 <193..272 CDD:225297 40/78 (51%)
ZK757.2NP_499190.2 DSPc 14..148 CDD:214551 51/139 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.