DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and DUSP9

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_011529425.1 Gene:DUSP9 / 1852 HGNCID:3076 Length:415 Species:Homo sapiens


Alignment Length:274 Identity:83/274 - (30%)
Similarity:125/274 - (45%) Gaps:62/274 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 IGANQKDYPNKRSRENLACDEVTSTTSSSTAMNGGGRTPALTRSCSSPAVYDIETHPASPVFPHL 141
            :|::..|..::..|::::|           .::..|.||        |.|....:.|.. :.|:|
Human   198 LGSDCSDAESEADRDSMSC-----------GLDSEGATP--------PPVGLRASFPVQ-ILPNL 242

  Fly   142 LLGNGRDA---DDPSSVGANCVLNVTCQSPNESHLQG-LKYMQIPASDTPHQNIKQYFQEAYDFI 202
            .||:.||:   :..:.:|...:||||...||.....| ..|.|||.||...||:.::|.||.:||
Human   243 YLGSARDSANLESLAKLGIRYILNVTPNLPNFFEKNGDFHYKQIPISDHWSQNLSRFFPEAIEFI 307

  Fly   203 EDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELE 267
            ::|......||:||.||:|||.|:.:||:|:...|||.:||.|||..:..||||.|||||||:.|
Human   308 DEALSQNCGVLVHCLAGVSRSVTVTVAYLMQKLHLSLNDAYDLVKRKKSNISPNFNFMGQLLDFE 372

  Fly   268 QNLRKSGVLAPATPHLNSPSNPSSSSVGLSTQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDG 332
            ::||.                                      |:|..:|:|.....|.|.:...
Human   373 RSLRL--------------------------------------EERHSQEQGSGGQASAASNPPS 399

  Fly   333 FDYDDVDSGSGSLA 346
            |.......|:..||
Human   400 FFTTPTSDGAFELA 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 61/137 (45%)
CDC14 <193..272 CDD:225297 40/78 (51%)
DUSP9XP_011529425.1 DSP_MapKP 38..169 CDD:238723
CDC14 224..373 CDD:225297 65/157 (41%)
DSPc 235..372 CDD:238073 61/137 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.