DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and DUSP7

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001938.2 Gene:DUSP7 / 1849 HGNCID:3073 Length:419 Species:Homo sapiens


Alignment Length:269 Identity:91/269 - (33%)
Similarity:133/269 - (49%) Gaps:40/269 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 APCLLLFMPIQNTNNNN------RIGAN--QKDYPNKRSRENLACDEVTSTTSSSTAMNGGG--- 112
            ||..:|.:.:|...::.      :.|.|  |.:| ::....|:......|::..::.:..||   
Human   149 APASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEY-SEHCETNVDSSSSPSSSPPTSVLGLGGLRI 212

  Fly   113 -----------RTP-ALTRSCSSPAVYDIETHPASPV--FPHLLLGNGRDA---DDPSSVGANCV 160
                       ..| :.|.|..||..   .:.||.||  .|:|.||..:|:   |.....|...:
Human   213 SSDCSDGESDRELPSSATESDGSPVP---SSQPAFPVQILPYLYLGCAKDSTNLDVLGKYGIKYI 274

  Fly   161 LNVTCQSPNE-SHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSA 224
            ||||...||. .|.....|.|||.||...||:.|:|.||..||::||.....||:||.||||||.
Human   275 LNVTPNLPNAFEHGGEFTYKQIPISDHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSV 339

  Fly   225 TIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSP--- 286
            |:.:||:|:..:|||.:||..||..:..||||.|||||||:.|:.|   |:.:|...|.:|.   
Human   340 TVTVAYLMQKMNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTL---GLSSPCDNHASSEQLY 401

  Fly   287 -SNPSSSSV 294
             |.|::.::
Human   402 FSTPTNHNL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 66/139 (47%)
CDC14 <193..272 CDD:225297 42/78 (54%)
DUSP7NP_001938.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..47
DSP_MapKP 55..186 CDD:238723 8/37 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..240 5/26 (19%)
DSP_DUSP7 240..388 CDD:350491 69/150 (46%)
Substrate binding. /evidence=ECO:0000269|PubMed:26057789, ECO:0007744|PDB:4Y2E 331..337 4/5 (80%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.940

Return to query results.
Submit another query.