DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and C24F3.2

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_501870.1 Gene:C24F3.2 / 177903 WormBaseID:WBGene00007697 Length:272 Species:Caenorhabditis elegans


Alignment Length:161 Identity:42/161 - (26%)
Similarity:73/161 - (45%) Gaps:12/161 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   160 VLNVTCQSPNESH-LQGLKYMQIPASDTPHQNI--KQYFQEAYDFIEDARKTGSRVLLHCHAGIS 221
            ||.:|.:..:|.. :.|:.|..:...|.|.:.|  ....:.|..:|.:..:....|.:||.|.:|
 Worm    33 VLTLTTEPISEKQKIGGVDYKFLHLLDMPDEPILDNAILETAVLYINEGVEKEENVGVHCLAAVS 97

  Fly   222 RSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSP 286
            ||.:|..||:|......:.:|.|:::..|..|.||..|:.||...|    :||:...|..:.|..
 Worm    98 RSVSICAAYLMYKNQWPVEKALKMIESVRKTIGPNAGFLAQLKIWE----RSGMSFSADQYKNLK 158

  Fly   287 SN-PSSSSVGLSTQSSQLVEQPEEEEKREQR 316
            .: |..:.|    .|..:..||..:::.:.|
 Worm   159 IDIPGITCV----DSKTIWRQPVIDDQTKVR 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 31/109 (28%)
CDC14 <193..272 CDD:225297 23/78 (29%)
C24F3.2NP_501870.1 DSPc 3..143 CDD:238073 31/109 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.