DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp5

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_997730.1 Gene:dusp5 / 114436 ZFINID:ZDB-GENE-010625-1 Length:368 Species:Danio rerio


Alignment Length:270 Identity:81/270 - (30%)
Similarity:128/270 - (47%) Gaps:28/270 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 DSVSHIQSEMKMRIKREAPCLLLFMPIQNTNNNNRIGANQKDYPNKRSRENLACDEVTSTTSSST 106
            |...|:|     ::|:::...::...:.:..::..|...:..|.|..:.....|.|..|...|..
Zfish    87 DRTPHLQ-----KLKKDSIAQIVINTLSHLTSSASICFLKGGYENFHAHYPELCTETRSVEVSED 146

  Fly   107 AMNGGGRTPALTRSCSSPAVY---DIETHPASPVFPHLLLGNGRDA---DDPSSVGANCVLNVTC 165
            ....|     ::..|...|.:   |.:......:.|.|.||:...|   |..|.:....:|||:.
Zfish   147 KSERG-----VSSHCDKLASHHKPDYDQGRPVEILPFLYLGSAYHACRQDYLSDLHITALLNVSR 206

  Fly   166 QSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAY 230
            :....:..| ..|..||..|:...:|..:||||.||||..:..|.:||:||.||||||.||.:||
Zfish   207 RDSRPARGQ-YNYKWIPVEDSHTADISSHFQEAIDFIERVKAEGGKVLVHCEAGISRSPTICMAY 270

  Fly   231 VMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSPS---NPS-- 290
            :|:.:.|.|.:|:.:::..|.|||||.:||||||:.|..:..|      ||.|.:|:   .|:  
Zfish   271 IMKTQRLRLEQAFDVIRQRRAIISPNFSFMGQLLQFESEVVSS------TPPLVTPAAQETPTFF 329

  Fly   291 SSSVGLSTQS 300
            |....|.|:|
Zfish   330 SGDFTLETES 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 55/136 (40%)
CDC14 <193..272 CDD:225297 40/78 (51%)
dusp5NP_997730.1 DSP_MapKP 5..135 CDD:238723 7/52 (13%)
DSPc 172..307 CDD:238073 55/135 (41%)
CDC14 <193..327 CDD:225297 55/140 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.