DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and DUSP12

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_009171.1 Gene:DUSP12 / 11266 HGNCID:3067 Length:340 Species:Homo sapiens


Alignment Length:292 Identity:75/292 - (25%)
Similarity:117/292 - (40%) Gaps:55/292 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PALTR-SCSSPAVYDIETHPASPVFPHLLLGNGRDADDPS---SVGANCVLNVTCQSPN---ESH 172
            |:.:| ||:...:         .|.|.|..|......:|.   ..|...||.|..:.|:   ...
Human    16 PSASRVSCAGQML---------EVQPGLYFGGAAAVAEPDHLREAGITAVLTVDSEEPSFKAGPG 71

  Fly   173 LQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSL 237
            ::.|..:.:||.|.|..::..:......||..||..|..||:|||||:|||..|..|::|:...|
Human    72 VEDLWRLFVPALDKPETDLLSHLDRCVAFIGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQL 136

  Fly   238 SLLEAYKLVKVARPIISPNLNF---------MGQLLELEQNLRKSGVLAPAT---PHL-NSPS-- 287
            ...:||:.:::.:|....|..|         ||..::....:.|...|...|   |.| |.|.  
Human   137 PFEKAYEKLQILKPEAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQEL 201

  Fly   288 ---NPSSSSVGLSTQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAGSN 349
               :|::.|.||         :.|...|..:..|...:|.|..         |...|||.:|.::
Human   202 FAVDPTTVSQGL---------KDEVLYKCRKCRRSLFRSSSIL---------DHREGSGPIAFAH 248

  Fly   350 CSSRLT-SPPITPDDEAPSTSAAASSVSELDS 380
              .|:| |..:|...:|..||.....|..::|
Human   249 --KRMTPSSMLTTGRQAQCTSYFIEPVQWMES 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 41/148 (28%)
CDC14 <193..272 CDD:225297 26/87 (30%)
DUSP12NP_009171.1 DSPc 26..166 CDD:238073 39/148 (26%)
Substrate binding. /evidence=ECO:0000305|PubMed:24531476, ECO:0007744|PDB:4KI9 116..121 3/4 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.