DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and DUSP10

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_009138.1 Gene:DUSP10 / 11221 HGNCID:3065 Length:482 Species:Homo sapiens


Alignment Length:394 Identity:118/394 - (29%)
Similarity:172/394 - (43%) Gaps:126/394 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ETQSSSNNNSNNTTTATSTAR--------NNNSHNGRCE-CDGDGDSVSHIQSEM---------- 51
            :||:.:   :..||||..|:.        |||.:.|... ..|.|..||....::          
Human    93 QTQAIA---AGTTTTAIGTSTTCPANQMVNNNENTGSLSPSSGVGSPVSGTPKQLASIKIIYPND 154

  Fly    52 ---------KMRIKREAPCLLLFMPIQNTNNNNRIGA---NQKDYPNKR---------------- 88
                     |..:..:.|.::...|....|.::..||   |..|..::|                
Human   155 LAKKMTKCSKSHLPSQGPVIIDCRPFMEYNKSHIQGAVHINCADKISRRRLQQGKITVLDLISCR 219

  Fly    89 ----------SRENLACDEVTSTTS-----------------------------SSTAMN----- 109
                      |:|.:..||.|:..|                             ||...|     
Human   220 EGKDSFKRIFSKEIIVYDENTNEPSRVMPSQPLHIVLESLKREGKEPLVLKGGLSSFKQNHENLC 284

  Fly   110 ------------GGGRTPALTRSCSS------PAVYDIETHPASPVFPHLLLGNGRDADDPSS-- 154
                        |||.:.|     ||      |...|||....:|:.|.|.|||.:||.|..:  
Human   285 DNSLQLQECREVGGGASAA-----SSLLPQPIPTTPDIENAELTPILPFLFLGNEQDAQDLDTMQ 344

  Fly   155 -VGANCVLNVTCQSPNESHLQGL-KYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCH 217
             :....|:|||...|...:.:|| .|.::||:|:..||::|||:||::|||:|.:.|..:|:||.
Human   345 RLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFEFIEEAHQCGKGLLIHCQ 409

  Fly   218 AGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPH 282
            ||:||||||.|||:|::..:::.:|||.||..||||||||||||||||.|::| .:||    ||.
Human   410 AGVSRSATIVIAYLMKHTRMTMTDAYKFVKGKRPIISPNLNFMGQLLEFEEDL-NNGV----TPR 469

  Fly   283 LNSP 286
            :.:|
Human   470 ILTP 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 68/137 (50%)
CDC14 <193..272 CDD:225297 48/78 (62%)
DUSP10NP_009138.1 DSP_MapKP 149..284 CDD:238723 18/134 (13%)
Interaction with MAP kinases 199..215 1/15 (7%)
DSPc 321..459 CDD:238073 68/137 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 127 1.000 Domainoid score I5398
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3731
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0006093
OrthoInspector 1 1.000 - - oto89824
orthoMCL 1 0.900 - - OOG6_107759
Panther 1 1.100 - - LDO PTHR10159
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2281
SonicParanoid 1 1.000 - - X5190
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.800

Return to query results.
Submit another query.