DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and LOC108179555

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_017206935.2 Gene:LOC108179555 / 108179555 -ID:- Length:251 Species:Danio rerio


Alignment Length:262 Identity:56/262 - (21%)
Similarity:104/262 - (39%) Gaps:59/262 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SVSHIQSEMKMRIKREAPCLLLFMPIQNTNNNNRIGANQKDYPNKRSRENLACDEVTSTTSSSTA 107
            ::||:.:...:|:.|:....|:.....:         ||:..|.            .....||..
Zfish    11 AISHMINRKNIRMSRDLLTQLVVFACHH---------NQQQQPG------------LMPEFSSID 54

  Fly   108 MNGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVT-------- 164
            :|.......:......|:.|   ..|.|.|:|::.:.:.:.|.:.:.:..   :|:|        
Zfish    55 INHPQTISQMYLRIVKPSQY---WTPVSEVWPNVFIADEKTARNKAKLKK---MNITHIVNAVPL 113

  Fly   165 ----------CQSPNESHL---QGLKYMQIPASDTPHQNIKQYFQEAYDFIEDA-RKTGSRVLLH 215
                      .|..|.::.   .||.....|       ||.|.|..|.:|:..| ..|.::|||:
Zfish   114 SLKEEEWKDYYQKKNITYYNVRSGLGVQGWP-------NIAQLFSPAAEFLHKALSDTKNKVLLY 171

  Fly   216 CHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPI-ISPNLNFMGQLLELEQNLRKSGVLAPA 279
            |..|:::|..:.:||:|.::.:.|.||::.|...|.: ||  .:::.||:.|..:|.|...|...
Zfish   172 CSEGLNQSVVLFMAYLMIHQRMKLEEAFEFVLERRRMWIS--RDYLNQLVMLNLDLAKLRELNEC 234

  Fly   280 TP 281
            .|
Zfish   235 RP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 38/156 (24%)
CDC14 <193..272 CDD:225297 26/80 (33%)
LOC108179555XP_017206935.2 PTPc 77..211 CDD:328744 34/143 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.