DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and LOC105947969

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_012823027.1 Gene:LOC105947969 / 105947969 -ID:- Length:189 Species:Xenopus tropicalis


Alignment Length:154 Identity:50/154 - (32%)
Similarity:76/154 - (49%) Gaps:11/154 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   131 THPASPVFPHLLLGNGRDADDPS---SVGANCVLNVTC------QSPNESHLQGLKYMQIPASDT 186
            |...:.|:|.|.||:...|.|.:   ::|...|||...      ..|.......:.|..|.|.|.
 Frog    27 TGHVNQVWPRLYLGDAFTARDKAALRALGITHVLNAASGKYQINTGPEFYRDLNIDYYGIEAFDD 91

  Fly   187 PHQNIKQYFQEAYDFIEDARKTG-SRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVAR 250
            |:.::..||..|..||:...::. .||.:||..||||:|::.:|::|..:..|||:|.:.|...|
 Frog    92 PNFDLSVYFHPAAHFIKAGLQSAKGRVFVHCAMGISRAASLVLAFLMISEGFSLLDALRSVSEHR 156

  Fly   251 PIISPNLNFMGQLLELEQNLRKSG 274
            . ||||..|:.||.:|:..|...|
 Frog   157 D-ISPNHGFLEQLRQLDIELAGKG 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 46/143 (32%)
CDC14 <193..272 CDD:225297 31/79 (39%)
LOC105947969XP_012823027.1 DSPc 29..172 CDD:238073 46/143 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.