DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and Styx

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001258470.1 Gene:Styx / 100912536 RGDID:1594806 Length:223 Species:Rattus norvegicus


Alignment Length:159 Identity:51/159 - (32%)
Similarity:81/159 - (50%) Gaps:16/159 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 SVGANCVLNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHA 218
            ::.||.:      .||...|  .:|:.:..:|.|.:||.::|....:||:.:.:.|.:||:|.:|
  Rat    66 NIEANFI------KPNFQQL--FRYLVLDIADNPVENIIRFFPMTKEFIDGSLQNGGKVLVHGNA 122

  Fly   219 GISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHL 283
            ||||||...|||:|....:...:|:..|:..|..|:||..|:.||.|.|     :..||..|..:
  Rat   123 GISRSAAFVIAYIMETFGMKYRDAFAYVQERRFCINPNAGFVHQLQEYE-----AIYLAKLTIQM 182

  Fly   284 NSPSN-PSSSSVGLSTQSSQLVEQPEEEE 311
            .||.. ..|.||...|..|  |::..|::
  Rat   183 MSPLQIERSLSVHSGTTGS--VKRTYEDD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 38/112 (34%)
CDC14 <193..272 CDD:225297 29/78 (37%)
StyxNP_001258470.1 DSP_STYX 25..175 CDD:350372 39/121 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.