Sequence 1: | NP_524273.1 | Gene: | puc / 40958 | FlyBaseID: | FBgn0243512 | Length: | 476 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_005170620.1 | Gene: | epm2a / 100535304 | ZFINID: | ZDB-GENE-100922-143 | Length: | 322 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 44/203 - (21%) |
---|---|---|---|
Similarity: | 64/203 - (31%) | Gaps: | 76/203 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 GRTPALTRSCSSPAVYD-------IETHPA-------------------------------SPVF 138
Fly 139 PHLLLGN-GRDADD-----PSSVGANCVLNVTCQSP--NESH--------------------LQG 175
Fly 176 LKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLL 240
Fly 241 EAYKLVKV 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
puc | NP_524273.1 | DSPc | 133..267 | CDD:238073 | 35/175 (20%) |
CDC14 | <193..272 | CDD:225297 | 17/56 (30%) | ||
epm2a | XP_005170620.1 | CBM20_laforin | 3..112 | CDD:99881 | 10/31 (32%) |
PTPc | 141..288 | CDD:304379 | 34/142 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |