DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp26

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002933015.2 Gene:dusp26 / 100493443 XenbaseID:XB-GENE-950157 Length:190 Species:Xenopus tropicalis


Alignment Length:152 Identity:57/152 - (37%)
Similarity:86/152 - (56%) Gaps:15/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 IETHPASPVFPHLLLGNGRDADDPSSVGANCVLNVT-----CQS---PNESHLQG--LKYMQIPA 183
            |:.| |..|:|:|.||   |.|..:..|....||:|     |.|   ..|.:.:|  :.||.|.|
 Frog    40 IKQH-ADEVWPNLYLG---DQDIAADKGELLRLNITHILNACHSRFRGGEDYYKGMNISYMGIEA 100

  Fly   184 SDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKV 248
            .|:...::..:|..|.|||..|.:...::|:||..|:|||||:.:||:|.:.:::|:||...||.
 Frog   101 HDSEIFDMSIHFYPAADFIHKALRGRGKILVHCAVGVSRSATLVLAYLMIHHNMTLVEAITTVKE 165

  Fly   249 ARPIISPNLNFMGQLLELEQNL 270
            .|.|| ||..|:.|||.|:::|
 Frog   166 RRGII-PNRGFLRQLLNLDKSL 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 53/143 (37%)
CDC14 <193..272 CDD:225297 34/78 (44%)
dusp26XP_002933015.2 DUSP26 44..186 CDD:350426 54/145 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.