DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and LOC100492691

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_031762253.1 Gene:LOC100492691 / 100492691 -ID:- Length:182 Species:Xenopus tropicalis


Alignment Length:169 Identity:60/169 - (35%)
Similarity:85/169 - (50%) Gaps:21/169 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPAVYDIET---------HPASPVFPHLLLGNGRDADDPS---SVGANCVLNVT-----CQSPNE 170
            ||:||.:|.         |....|||.|.||:...|:|.|   .:|...:||..     |.....
 Frog     8 SPSVYQLEALLDAYSGNLHHVDQVFPSLFLGDVVIANDKSKLKKMGITHILNAAHASWECTGDGI 72

  Fly   171 SHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKT-GSRVLLHCHAGISRSATIAIAYVMRY 234
            .:...::|..|.|.|.|..|::.:|..|.:||..|..| ..::|:||..|.|||||:.:||:|.|
 Frog    73 DYGPEIQYYGITAEDCPQFNMRLFFYPAAEFIHKALNTPNGKILVHCVLGKSRSATLVLAYLMIY 137

  Fly   235 KSLSLLEAYKLVKVARPIISPNLNFMGQL--LELEQNLR 271
            :..||.:|.:.| ..|..|:||..|:.||  ||.||:.|
 Frog   138 QHFSLEDAIRHV-AKRRCIAPNRGFLEQLQSLEAEQHSR 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 51/144 (35%)
CDC14 <193..272 CDD:225297 35/82 (43%)
LOC100492691XP_031762253.1 DUSP3-like 28..169 CDD:350365 49/141 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.