DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp13

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002937175.1 Gene:dusp13 / 100492068 XenbaseID:XB-GENE-940215 Length:209 Species:Xenopus tropicalis


Alignment Length:199 Identity:64/199 - (32%)
Similarity:98/199 - (49%) Gaps:39/199 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 TTSSSTAMNGGGRTPALTRSCSSPAVYDIE-----------------THPASPVFPHLLLGNGRD 148
            |.||||   ..|...:||         |||                 ::....|:|:|.||:...
 Frog     5 TVSSST---HSGNEQSLT---------DIESTVGELQTLLNSRRTSFSNHVDEVWPNLFLGDLAT 57

  Fly   149 ADDPS---SVGANCVLNVT-----CQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDA 205
            |::..   .:|...:||..     |:..::.:...:.|..:||.|.|..::.:||..|..||..|
 Frog    58 ANNRYELWKMGITHILNAAHGNRFCEGNSDFYSASIAYHGVPAYDVPDFDMSKYFNSASAFIHQA 122

  Fly   206 RKT-GSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQN 269
            ..| |:|:|:||..|||||||:.:||:|.|..::|.:|.:.|:..| .:|||..|:.|||:|:..
 Frog   123 LNTSGARLLVHCVVGISRSATLVLAYLMIYHQMTLTQAIQRVQENR-WVSPNPGFLRQLLKLDGE 186

  Fly   270 LRKS 273
            |.||
 Frog   187 LCKS 190

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 49/142 (35%)
CDC14 <193..272 CDD:225297 36/79 (46%)
dusp13XP_002937175.1 DUSP13A 43..187 CDD:350428 50/144 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.