DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and ssh3

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002938546.1 Gene:ssh3 / 100488263 XenbaseID:XB-GENE-5816848 Length:688 Species:Xenopus tropicalis


Alignment Length:333 Identity:87/333 - (26%)
Similarity:141/333 - (42%) Gaps:76/333 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 SPVFPHLLLGNGRDADDPSSVGANCV---LNVTCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQ 196
            |.:||:|.||:..:|.:...:..|.|   ||||.:..| ...:..||:.|...|..:.|:.||::
 Frog   298 SEIFPYLYLGSEWNASNLEELQKNKVSHILNVTREIDN-FFPELFKYLNIRVLDEENTNLMQYWK 361

  Fly   197 EAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMG 261
            |.:.||...|:.|||||:||..|:||||:..|||.|:....:|..|.:.||..|.|:.||..|:.
 Frog   362 ETHAFITAGRRQGSRVLVHCKMGVSRSASTVIAYAMKEYEWTLETAMRHVKERRNIVQPNAGFIR 426

  Fly   262 QLLELEQNLRKSGVL---------------APATP-----------HLNSPSNPSSSSVGLSTQS 300
            ||...:      |:|               ||..|           |..||..|....:.|.|..
 Frog   427 QLQTYQ------GILGASKQRHSYLWDPSSAPPLPQVFPPPKNFSRHTTSPLTPRLQKMNLRTLM 485

  Fly   301 SQLVEQPEEEEKREQRERGKSKSDSEAMDEDGF--DYDDVDSGSGSLAGS---NCSSRLTSPPIT 360
            ..:.|....:...|::|     |.|| ::|:.|  ..:.::|.|.:|.|:   .....|....||
 Frog   486 RSISEMDATDTISEEKE-----STSE-LEENIFKQKVNILESTSKNLQGTFPKRNEHVLYKEQIT 544

  Fly   361 PDDE--------APSTSAAASSVSEL---------------------DSPSSTSSSSGICSLLQS 396
            .:::        .|.:.....::.|:                     :|.|.|..:|.:..:.:|
 Frog   545 LEEDKKLMKLEKGPESEVKNHTLQEIKETEVSIRLKEAKEKDQETNKESSSITQQNSSLDEVFES 609

  Fly   397 TSSSVSPR 404
            ::.:.||:
 Frog   610 STPTRSPQ 617

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 52/134 (39%)
CDC14 <193..272 CDD:225297 33/78 (42%)
ssh3XP_002938546.1 SSH-N 3..231 CDD:212166
DEK_C 238..291 CDD:370106
PTP_DSP_cys 294..437 CDD:391942 54/145 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.