DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp8b

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_002665347.3 Gene:dusp8b / 100330259 ZFINID:ZDB-GENE-120914-3 Length:499 Species:Danio rerio


Alignment Length:357 Identity:102/357 - (28%)
Similarity:151/357 - (42%) Gaps:108/357 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   115 PA--LTRSCSSPAVYDIETHPASPVFPHLLLGNGRDA---DDPSSVGANCVLNV--TCQSP---N 169
            ||  |..|.|.|.:......| :.:.|||.||:.||.   :..|..|...|||.  ||..|   :
Zfish    40 PASILPLSLSQPCLPVANIGP-TRILPHLYLGSQRDVLNKEVMSQNGITYVLNASNTCPKPDFIS 103

  Fly   170 ESHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAYVMRY 234
            |:|     :|:||.:|:..:.:..:.::..:||:.|:.:..||::||.|||||||||||||:|:.
Zfish   104 ENH-----FMRIPVNDSYCEKLLPWLEKTNEFIDKAKVSNCRVIVHCLAGISRSATIAIAYIMKT 163

  Fly   235 KSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNL--RKSGVLAPATPHLNSPSNPSSSSVGLS 297
            ..||..:||:.||..||.||||.||:|||||.|:.|  :||         |..|....:|:|   
Zfish   164 MGLSSDDAYRFVKDRRPSISPNFNFLGQLLEFERGLEMKKS---------LPCPIRMEASTV--- 216

  Fly   298 TQSSQLVEQPEEEEKREQRERGKSKSDSEAMDEDGFDYDDVDSGSGSLAGSNCSSRLTSPPITPD 362
                           :|..|..|.::|.:.                       :|:.|...:.| 
Zfish   217 ---------------KEVTEIRKMENDDQR-----------------------TSQTTEITVNP- 242

  Fly   363 DEAPSTSAAASSVSELDSPSSTSSSSGICSLLQSTSSSVSPRAISKPNLLSPTRQLALFKRNSPA 427
                              ||.||....:.||..||...:..:.:.                   .
Zfish   243 ------------------PSPTSLQKDLSSLHLSTEKILQNKRLK-------------------C 270

  Fly   428 KLRLDLESSYAPASPIPNTMPWLSVPSTP-VC 458
            ...||::|.|: :||..|:.|.....:|| :|
Zfish   271 SFSLDIKSVYS-SSPNHNSSPNSDSENTPKIC 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 62/141 (44%)
CDC14 <193..272 CDD:225297 42/80 (53%)
dusp8bXP_002665347.3 RHOD <13..36 CDD:294087
DSPc 59..196 CDD:238073 62/142 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.