DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp10

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_003200822.1 Gene:dusp10 / 100034609 ZFINID:ZDB-GENE-041014-271 Length:459 Species:Danio rerio


Alignment Length:186 Identity:84/186 - (45%)
Similarity:116/186 - (62%) Gaps:14/186 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   105 STAMNGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADD---PSSVGANCVLNVTCQ 166
            |.||...|..|.     |.|:..|||....:.|.|.|.|||.|||.|   ...:....|||||..
Zfish   275 SGAMGLSGALPH-----SLPSTPDIENAELTAVLPFLYLGNERDAQDLELLQRLDIGFVLNVTTH 334

  Fly   167 SPNESH-LQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDARKTGSRVLLHCHAGISRSATIAIAY 230
            .|...: :....|.::||:|:..||::|||:||::|||:|.:.|..:|:||.||:||||||.|||
Zfish   335 LPLYHYDIARFCYKRLPATDSNKQNLRQYFEEAFEFIEEAHQAGRGLLIHCQAGVSRSATIVIAY 399

  Fly   231 VMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSGVLAPATPHLNSP 286
            :|::..:::.:|||.||..||||||||||||||||.|::| .:|:    ||.:.:|
Zfish   400 LMKHTWMTMTDAYKFVKSRRPIISPNLNFMGQLLEFEEDL-NNGI----TPRILTP 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 68/137 (50%)
CDC14 <193..272 CDD:225297 48/78 (62%)
dusp10XP_003200822.1 DSP_MapKP 127..262 CDD:238723
DSPc 298..436 CDD:238073 68/137 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5537
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 1 1.000 - - FOG0006093
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107759
Panther 1 1.100 - - LDO PTHR10159
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5190
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.820

Return to query results.
Submit another query.