DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and si:ch211-223p8.8

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001139098.1 Gene:si:ch211-223p8.8 / 100004731 ZFINID:ZDB-GENE-090313-91 Length:186 Species:Danio rerio


Alignment Length:170 Identity:55/170 - (32%)
Similarity:89/170 - (52%) Gaps:19/170 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 SPAVYDIE---------THPASPVFPHLLLGN---GRDADDPSSVGANCVLN-----VTCQSPNE 170
            ||.:.::|         .:....|:|:|.||:   ..|.....|:|...|||     :.|:..::
Zfish    15 SPTIEELEGILHGGQLSCNHVDEVWPNLFLGDMYMSHDRYGLWSLGVTHVLNAAHGKMCCKGNDD 79

  Fly   171 SHLQGLKYMQIPASDTPHQNIKQYFQEAYDFIEDA-RKTGSRVLLHCHAGISRSATIAIAYVMRY 234
            .:...:||..:||:|.|..:|..:|..:..:|.|| ..||::|.:||..|:||||.:.:||:|.|
Zfish    80 YYGTTVKYYGVPANDLPTFDISPFFYPSAQYIHDALSTTGAKVFVHCAVGMSRSAALVLAYLMIY 144

  Fly   235 KSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLRKSG 274
            .:.||::|...||..|.|. ||..|:.||:.|:..|:..|
Zfish   145 CNFSLVDAILKVKERRWIF-PNRGFLKQLITLDNELKLQG 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 49/142 (35%)
CDC14 <193..272 CDD:225297 32/79 (41%)
si:ch211-223p8.8NP_001139098.1 DSPc 34..176 CDD:238073 49/142 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.