DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp22b

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:NP_001017742.2 Gene:dusp22b / 100002272 ZFINID:ZDB-GENE-050417-257 Length:183 Species:Danio rerio


Alignment Length:193 Identity:62/193 - (32%)
Similarity:94/193 - (48%) Gaps:24/193 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   137 VFPHLLLGNGRDADDPSSVGANCVLNV-TCQSPNESHLQGLKYMQIPASDTPHQNIKQYFQEAYD 200
            |.|.|.|||.:||.|...:..|.:.:: :........||.:.|:.|.|:|:|.||:.|:|:::..
Zfish     8 VLPDLYLGNFKDARDREQLARNNITHILSIHDTAAPILQEMTYLCIAAADSPTQNLIQHFRQSIA 72

  Fly   201 FIEDARKTGSRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLE 265
            ||..:|..|...|:||.||:|||.|:.:||:|...:|...||...||:|||..|||..|..||.|
Zfish    73 FIHQSRLKGEGCLVHCLAGVSRSVTLVVAYIMTVTTLGWQEALAAVKIARPCASPNTGFQNQLQE 137

  Fly   266 LEQNLRKSGVLAPATPHLNSPSNPSSSSVGLSTQSSQLVEQP--EEEEKREQRERGKSKSDSE 326
            .:     :|.|......|                ..:..|.|  :||:.|....:..::.|:|
Zfish   138 FQ-----TGELQQFREWL----------------KEEYKENPFNDEEDIRNLLTKASTEEDAE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 52/130 (40%)
CDC14 <193..272 CDD:225297 33/78 (42%)
dusp22bNP_001017742.2 DSPc 4..139 CDD:238073 52/130 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.