DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment puc and dusp3a

DIOPT Version :9

Sequence 1:NP_524273.1 Gene:puc / 40958 FlyBaseID:FBgn0243512 Length:476 Species:Drosophila melanogaster
Sequence 2:XP_001340818.2 Gene:dusp3a / 100000665 ZFINID:ZDB-GENE-111207-3 Length:200 Species:Danio rerio


Alignment Length:200 Identity:62/200 - (31%)
Similarity:89/200 - (44%) Gaps:35/200 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 EVTSTTSSSTAM-------NGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDP-- 152
            |||.|.:.:|..       :|.|             .|.:.....:.|||.:.:||...|.:.  
Zfish    13 EVTVTDTEATVQQLNKLLSDGSG-------------FYSLPAQHFNEVFPRIYIGNAFVAQNVMR 64

  Fly   153 -SSVGANCVLNVTCQSPNESHLQ---------GLKYMQIPASDTPHQNIKQYFQEAYDFIEDARK 207
             ..:|...:||| .:..:..|:.         |:.|..|.|:||...||..:|:||.|||:.|..
Zfish    65 LQRLGVTHILNV-AEGNSFMHVNTNAEFYAGTGITYHGIQANDTEQFNISAFFEEAADFIDKALA 128

  Fly   208 TG-SRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLR 271
            .| .:|.:||..|.|||.||.|||:|....:.:..|...|:..|. |.||..|:.||.:|.:.|.
Zfish   129 HGKGKVYVHCREGYSRSPTIVIAYLMLRHKMDVRVATATVRHKRE-IGPNGGFLCQLCQLNEKLA 192

  Fly   272 KSGVL 276
            |.|.|
Zfish   193 KEGKL 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
pucNP_524273.1 DSPc 133..267 CDD:238073 49/146 (34%)
CDC14 <193..272 CDD:225297 32/79 (41%)
dusp3aXP_001340818.2 DSPc 45..188 CDD:238073 49/144 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.