Sequence 1: | NP_524273.1 | Gene: | puc / 40958 | FlyBaseID: | FBgn0243512 | Length: | 476 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001340818.2 | Gene: | dusp3a / 100000665 | ZFINID: | ZDB-GENE-111207-3 | Length: | 200 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 62/200 - (31%) |
---|---|---|---|
Similarity: | 89/200 - (44%) | Gaps: | 35/200 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 97 EVTSTTSSSTAM-------NGGGRTPALTRSCSSPAVYDIETHPASPVFPHLLLGNGRDADDP-- 152
Fly 153 -SSVGANCVLNVTCQSPNESHLQ---------GLKYMQIPASDTPHQNIKQYFQEAYDFIEDARK 207
Fly 208 TG-SRVLLHCHAGISRSATIAIAYVMRYKSLSLLEAYKLVKVARPIISPNLNFMGQLLELEQNLR 271
Fly 272 KSGVL 276 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
puc | NP_524273.1 | DSPc | 133..267 | CDD:238073 | 49/146 (34%) |
CDC14 | <193..272 | CDD:225297 | 32/79 (41%) | ||
dusp3a | XP_001340818.2 | DSPc | 45..188 | CDD:238073 | 49/144 (34%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |