DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-B and hrh3

DIOPT Version :9

Sequence 1:NP_649764.1 Gene:mAChR-B / 40955 FlyBaseID:FBgn0037546 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001020689.1 Gene:hrh3 / 561773 ZFINID:ZDB-GENE-040724-204 Length:473 Species:Danio rerio


Alignment Length:389 Identity:101/389 - (25%)
Similarity:163/389 - (41%) Gaps:78/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 TILIAICLAICIILTVGGNILVLLAFIVDRNIRQPSNYFIASLAATDMLIGTVSMPFYTIYVLKG 197
            :|.:.:.:.:.:..||.||.||:|||:|::::|...|:|..:||..|.|:|...:|.|..|||.|
Zfish    64 SIFLTVLMTLLVFATVLGNALVILAFVVEKSLRTQGNFFFLNLAIADFLVGGFCIPVYIPYVLTG 128

  Fly   198 YWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAKYRSWR--TRTRVIYMVTITWII 260
            .|.||..||.|||.|||.:|..|.:.::||:.||:.||..|..||..:  |:..|:.|:.: |:.
Zfish   129 EWRLGRGLCKLWLVVDYMLCTASVFNIVLISFDRFQSVTKAVSYRCQKGITKDAVLKMLCV-WLA 192

  Fly   261 PALLFFISIFGWEHFTGKRDLLPGQCAVQFLKDPIFN-----TALIIGYYWTTLIVLFVLYAGIY 320
            ..||:..:|..|||.||...:..|:|..:|    .||     ||..:.:: |..|.:......||
Zfish   193 AFLLYGPAIISWEHITGGSVVPDGECYAEF----YFNWYFLMTASTVEFF-TPFISVTYFNLSIY 252

  Fly   321 KTAYDMQKRSEAKQRKMQ-SMVALSAGAMSGMAGHAAGIGVIEEKILKTKVE--LAGDQTDLDSA 382
                 :..|:....|:.| :.|.|.:..|..:     |.|.::.......||  ...|.......
Zfish   253 -----INIRNRCAMREEQPTYVRLRSFKMKPL-----GAGDVQRVFFVRPVEESRVADLASRSRC 307

  Fly   383 CTTVIKRLSGSGQANPLAVATEEVEKMTPEQRRASAAKIQ-------EEAKKREAAVDAEKSERS 440
            |                              |.||.||:.       .::|:|::.:       :
Zfish   308 C------------------------------RLASTAKVSAAEFGNGRQSKRRDSTL-------A 335

  Fly   441 SSPAFDSDEE-SSVNQAQQLITQQKLNNMRKRSSIGLVFGAQAALLATRGKGNLQKSTTNSKSI 503
            ..|....:|. .:.::||...........|.|..:       .|.||.|.:.:..|....|.::
Zfish   336 DLPPLQVEERILAASEAQFHYVDHSAGPHRHRPDM-------VASLANRFRLSRDKKVAKSLAV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-BNP_649764.1 7tm_1 150..>341 CDD:278431 70/198 (35%)
7tm_4 150..>336 CDD:304433 68/192 (35%)
hrh3NP_001020689.1 7tm_1 81..442 CDD:278431 98/372 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.