DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-B and 5-HT7

DIOPT Version :9

Sequence 1:NP_649764.1 Gene:mAChR-B / 40955 FlyBaseID:FBgn0037546 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001263131.1 Gene:5-HT7 / 43669 FlyBaseID:FBgn0004573 Length:564 Species:Drosophila melanogaster


Alignment Length:440 Identity:109/440 - (24%)
Similarity:168/440 - (38%) Gaps:147/440 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 KRLLEAAKIYGE-----SSDFNSWPVNEQLQWYRNFDVNNTNLLLAVRNQSSDGGSTMSGSSSDS 118
            |..:.|..:.||     |.||||                ::..|.|:.:.||.|..:.|||.|.|
  Fly    52 KATVPAPLVEGETESATSQDFNS----------------SSAFLGAIASASSTGSGSGSGSGSGS 100

  Fly   119 ----------------------------------EILGP----------------VLPPFALWQT 133
                                              ..|.|                ||||..   :
  Fly   101 GSGSGSYGLASMNSSPIAIVSYQGITSSNLGDSNTTLVPLSDTPLLLEEFAAGEFVLPPLT---S 162

  Fly   134 ILIAICLAICIILTVGGNILVLLAFIVDRNIRQPSNYFIASLAATDMLIGTVSMPFYTIYVLKGY 198
            |.::|.|.|.|:.||.||:||.:|..:.|.:|:|.||.:.|||.:|:.:..:.||...:|.:...
  Fly   163 IFVSIVLLIVILGTVVGNVLVCIAVCMVRKLRRPCNYLLVSLALSDLCVALLVMPMALLYEVLEK 227

  Fly   199 WDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAKYRSWRTRTRVIYMVTITWI---- 259
            |:.||:|||:|:|.|...|..|...:..|::|||.::....:|...||..|::..|.|.|:    
  Fly   228 WNFGPLLCDIWVSFDVLCCTASILNLCAISVDRYLAITKPLEYGVKRTPRRMMLCVGIVWLAAAC 292

  Fly   260 --IPALLFFISIFGWEHFTGKRDLLPGQ--CAV-QFLKDPIFNTALIIGYYWTTLIVLFVLYAGI 319
              :|.||    |.|.||...:     ||  |.| |.....|:.|   :|.::..|.|:..:|..|
  Fly   293 ISLPPLL----ILGNEHEDEE-----GQPICTVCQNFAYQIYAT---LGSFYIPLSVMLFVYYQI 345

  Fly   320 YKTAYDMQKRSEAKQRKMQ-------------------------------------SMVALSAGA 347
            ::.|..:....:..|..:|                                     |:...:.|.
  Fly   346 FRAARRIVLEEKRAQTHLQQALNGTGSPSAPQAPPLGHTELASSGNGQRHSSVGNTSLTYSTCGG 410

  Fly   348 MS----GMAGHAAGIGVIEEKIL-------KTKVELAGDQTDLDSACTTV 386
            :|    .:|||.:|.||.....|       |.:.:||.::    .|.||:
  Fly   411 LSSGGGALAGHGSGGGVSGSTGLLGSPHHKKLRFQLAKEK----KASTTL 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-BNP_649764.1 7tm_1 150..>341 CDD:278431 62/236 (26%)
7tm_4 150..>336 CDD:304433 60/194 (31%)
5-HT7NP_001263131.1 7tm_4 173..>342 CDD:304433 59/180 (33%)
7tm_1 179..507 CDD:278431 77/294 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.