DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-B and Dop1R1

DIOPT Version :9

Sequence 1:NP_649764.1 Gene:mAChR-B / 40955 FlyBaseID:FBgn0037546 Length:1019 Species:Drosophila melanogaster
Sequence 2:NP_001262563.1 Gene:Dop1R1 / 41726 FlyBaseID:FBgn0011582 Length:560 Species:Drosophila melanogaster


Alignment Length:231 Identity:64/231 - (27%)
Similarity:107/231 - (46%) Gaps:30/231 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   109 STMSGSSSDSEILGPVLPPFALWQTILIAICLAICIILTVGGNILVLLAFIVDRNIRQPSNYFIA 173
            |:.:.:|....|:|....|.:|...:::.|.|::.|.|:|.|||||.||...:|::|:..|.|:|
  Fly   104 SSWTNASEMDTIVGEEPEPLSLVSIVVVGIFLSVLIFLSVAGNILVCLAIYTERSLRRIGNLFLA 168

  Fly   174 SLAATDMLIGTVSMPFYTIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIA 238
            |||..|:.:.::.|.|..:..|.|||..|...||.|::.|......|...:..|::|||..:|..
  Fly   169 SLAIADLFVASLVMTFAGVNDLLGYWIFGAQFCDTWVAFDVMCSTASILNLCAISMDRYIHIKDP 233

  Fly   239 AKYRSWRTRTRVIYMVTITWIIPALLFFISIF---------------GWEHFTGKRDLLPGQCAV 288
            .:|..|.||...:..:...|::.|.:.|:.|.               |.::.|...||.|....|
  Fly   234 LRYGRWVTRRVAVITIAAIWLLAAFVSFVPISLGIHRPDQPLIFEDNGKKYPTCALDLTPTYAVV 298

  Fly   289 QFLKDPIFNTALIIGYYWTTLIVLFVLYAGIYKTAY 324
                      :..|.:|:..::::     |||...|
  Fly   299 ----------SSCISFYFPCVVMI-----GIYCRLY 319

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-BNP_649764.1 7tm_1 150..>341 CDD:278431 53/190 (28%)
7tm_4 150..>336 CDD:304433 53/190 (28%)
Dop1R1NP_001262563.1 7tm_4 134..>266 CDD:304433 45/131 (34%)
7tm_1 145..431 CDD:278431 53/190 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460630
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24247
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.