DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mAChR-B and LOC110438988

DIOPT Version :9

Sequence 1:NP_649764.1 Gene:mAChR-B / 40955 FlyBaseID:FBgn0037546 Length:1019 Species:Drosophila melanogaster
Sequence 2:XP_021328463.1 Gene:LOC110438988 / 110438988 -ID:- Length:259 Species:Danio rerio


Alignment Length:249 Identity:83/249 - (33%)
Similarity:143/249 - (57%) Gaps:12/249 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 MSGSSSDSEILGPVLPPFALWQTILIAICLAICIILTVGGNILVLLAFIVDRNIRQPSNYFIASL 175
            |:.||..:|...|: |.|..|:|.:|........::|:.||:||:::|.|:..:|..||||:.||
Zfish     1 MNLSSFINETDSPI-PGFISWKTAMITFITVPLSLITITGNVLVMISFRVNPLLRTVSNYFLLSL 64

  Fly   176 AATDMLIGTVSMPFYTIYVLKGYWDLGPMLCDLWLSVDYTVCLVSQYTVLLITIDRYCSVKIAAK 240
            |..|:::|::||..||.|:|...|.||.:.||:||:|||.....|...:|.|:||||.||.....
Zfish    65 AVADVILGSISMNLYTTYILLNGWTLGNLACDVWLAVDYVASNASVMNLLAISIDRYLSVMRPLT 129

  Fly   241 YRSWRTRTRVIYMVTITWIIPALLFFISIFGWEHFTGKRDLLPGQCAVQFLKDPIFNTALIIGYY 305
            ||:.||..|.:.|:::.|.|..:::..:|..|::..|:|.:...:|::|||.:|:......|..:
Zfish   130 YRAKRTPKRAMIMISLAWTISFVIWAPAILFWQYIVGERTVQENECSIQFLSEPVITFGTAIAAF 194

  Fly   306 WTTLIVLFVLYAGIYKTAYDMQKRSEAKQRKMQSMVALSAGAMSGMAGHAAGIG 359
            :..:.|:..||..:|:   :.:|||:    |:..::|    :..|..|:|:.:|
Zfish   195 YLPVSVMVALYWRVYR---ETEKRSQ----KLAGLMA----SQGGRTGNASQVG 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mAChR-BNP_649764.1 7tm_1 150..>341 CDD:278431 67/190 (35%)
7tm_4 150..>336 CDD:304433 66/185 (36%)
LOC110438988XP_021328463.1 7tm_GPCRs 23..>214 CDD:333717 65/193 (34%)
TM helix 1 25..49 CDD:320095 7/23 (30%)
TM helix 2 58..80 CDD:320095 10/21 (48%)
TM helix 3 96..118 CDD:320095 9/21 (43%)
TM helix 4 141..157 CDD:320095 3/15 (20%)
TM helix 5 183..206 CDD:320095 4/22 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1245472at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.