DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and CAJ1

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_010967.3 Gene:CAJ1 / 856772 SGDID:S000000850 Length:391 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:48/200 - (24%)
Similarity:87/200 - (43%) Gaps:39/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYD 89
            :..:||.|||:.:.|..|||.||.:.:|..|||::....:|..||:.:.:||::|.:..||..||
Yeast     4 ETEYYDILGIKPEATPTEIKKAYRRKAMETHPDKHPDDPDAQAKFQAVGEAYQVLSDPGLRSKYD 68

  Fly    90 KGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSF 154
                     |:.:: ..|.:...||.:|  ::.:.|......|..|...::.....:...:||..
Yeast    69 ---------QFGKE-DAVPQQGFEDASE--YFTAIFGGDGFKDWIGEFSLFKELNEATEMFGKED 121

  Fly   155 DRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKERYRRDQ 219
            :...||          .||.:....||        .|:.         .:||.|.::.::.:..:
Yeast   122 EEGTAA----------TETEKADESTD--------GGMV---------KHDTNKAESLKKDKLSK 159

  Fly   220 EEREQ 224
            |:||:
Yeast   160 EQREK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/62 (37%)
DnaJ 27..89 CDD:278647 23/61 (38%)
CAJ1NP_010967.3 DnaJ 2..>98 CDD:223560 31/105 (30%)
DnaJ-X 176..376 CDD:405064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.