DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and HLJ1

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_013884.1 Gene:HLJ1 / 855196 SGDID:S000004771 Length:224 Species:Saccharomyces cerevisiae


Alignment Length:209 Identity:52/209 - (24%)
Similarity:82/209 - (39%) Gaps:60/209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRL 87
            :|:.  |:.|.:.|:.|.:|||.||.||::..|||:| ....|.:.|:.||:|:|:|.|...|.:
Yeast    19 KHEF--YEILKVDRKATDSEIKKAYRKLAIKLHPDKN-SHPKAGEAFKVINRAFEVLSNEEKRSI 80

  Fly    88 YDK-----------------GIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSD--- 132
            ||:                 |...:||..           .:....|..|:.|||...|...   
Yeast    81 YDRIGRDPDDRQMPSRGAASGFRGSAGGS-----------PMGGGFEDMFFNSRFGGQRAGPPED 134

  Fly   133 ------SAGRTPI-----------------YDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETN 174
                  :||.:|.                 ..|..::.|..|..|.|:|....:..:   |.|.|
Yeast   135 IFDFLFNAGGSPFGASPFGPSASTFSFGGPGGFRVYTNNRGGSPFMRQQPRSRQQQQ---QAEEN 196

  Fly   175 RISGQTDMVLLAFI 188
            .::.|...:|:.||
Yeast   197 AVNSQLKNMLVLFI 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/62 (39%)
DnaJ 27..89 CDD:278647 24/61 (39%)
HLJ1NP_013884.1 DnaJ_bact 22..>154 CDD:274090 38/145 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.