DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and DJP1

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_012269.1 Gene:DJP1 / 854820 SGDID:S000001443 Length:432 Species:Saccharomyces cerevisiae


Alignment Length:254 Identity:63/254 - (24%)
Similarity:102/254 - (40%) Gaps:59/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK-- 90
            :||.||:....:..|||.||.|.|:..|||:|.....|.::|:.|::||::||:..||..|||  
Yeast     7 YYDLLGVSTTASSIEIKKAYRKKSIQEHPDKNPNDPTATERFQAISEAYQVLGDDDLRAKYDKYG 71

  Fly    91 -------GIVHTAGAQYA------------------QDVHDVAEPVVEDDAETKFY--------- 121
                   |....|..|::                  :::....|...||:||.:..         
Yeast    72 RKEAIPQGGFEDAAEQFSVIFGGDAFASYIGELMLLKNLQKTEELNAEDEAEKEKENVETMEESP 136

  Fly   122 ---KSRFQKSRVSDSAGRTPIYDFDEWSRN-------HYGKSFDRRQAAQAKYDRIKVQR--ETN 174
               |:....:.|..:.|.|...|....:|.       |.|...:.:..|:||..:.|:::  |..
Yeast   137 ADGKTNGTTNAVDAALGNTNEKDDKNKARTTSGNLTVHDGNKKNEQVGAEAKKKKTKLEQFEEEQ 201

  Fly   175 RISGQ--TDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKERYRRDQEEREQKLVGKQS 231
            .:..|  .|.:....|     ..|..|.||.||   ...|:.:::..|| |..|:..:|
Yeast   202 EVEKQKRVDQLSKTLI-----ERLSILTESVYD---DACKDSFKKKFEE-EANLLKMES 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/60 (40%)
DnaJ 27..89 CDD:278647 24/60 (40%)
DJP1NP_012269.1 PRK10767 7..>97 CDD:236757 30/89 (34%)
DnaJ-X 208..422 CDD:405064 14/53 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.