Sequence 1: | NP_001303469.1 | Gene: | CG11035 / 40953 | FlyBaseID: | FBgn0037544 | Length: | 231 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_012269.1 | Gene: | DJP1 / 854820 | SGDID: | S000001443 | Length: | 432 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 254 | Identity: | 63/254 - (24%) |
---|---|---|---|
Similarity: | 102/254 - (40%) | Gaps: | 59/254 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK-- 90
Fly 91 -------GIVHTAGAQYA------------------QDVHDVAEPVVEDDAETKFY--------- 121
Fly 122 ---KSRFQKSRVSDSAGRTPIYDFDEWSRN-------HYGKSFDRRQAAQAKYDRIKVQR--ETN 174
Fly 175 RISGQ--TDMVLLAFIFAGVAVYLMFLAESSYDTPKQKAKERYRRDQEEREQKLVGKQS 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11035 | NP_001303469.1 | DnaJ | 26..>89 | CDD:223560 | 24/60 (40%) |
DnaJ | 27..89 | CDD:278647 | 24/60 (40%) | ||
DJP1 | NP_012269.1 | PRK10767 | 7..>97 | CDD:236757 | 30/89 (34%) |
DnaJ-X | 208..422 | CDD:405064 | 14/53 (26%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |