DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and JJJ3

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_012631.3 Gene:JJJ3 / 853560 SGDID:S000003858 Length:172 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:41/147 - (27%)
Similarity:60/147 - (40%) Gaps:17/147 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGS-----ENAAKKFREINQAYEIL 79
            :|..:.::||:.|.|....||:|||.||....:..|||:...|     .|..  ..:|..||:||
Yeast     1 MSLVNSLTHYEILRIPSDATQDEIKKAYRNRLLNTHPDKLSKSIHDTVSNVT--INKIQDAYKIL 63

  Fly    80 GNYRLRRLYDKGIVHTAGAQYAQDVHDVAEPVVEDDAETKFYKSRFQKS----------RVSDSA 134
            .|.:.||.||:.|:.....|...:..|..:....||......|..|..:          ..|:|.
Yeast    64 SNIKTRREYDRLILENYKRQGFHNCGDGLDEFSLDDFSFDEDKLEFMMNCPRCQFVGGFHFSESL 128

  Fly   135 GRTPIYDFDEWSRNHYG 151
            ....|.:.|...|:|.|
Yeast   129 LDECIDNVDAMERSHSG 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 24/67 (36%)
DnaJ 27..89 CDD:278647 24/66 (36%)
JJJ3NP_012631.3 DnaJ 8..73 CDD:395170 24/66 (36%)
zf-CSL 93..164 CDD:398744 11/53 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.