DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and JJJ2

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_012373.2 Gene:JJJ2 / 853277 SGDID:S000003698 Length:583 Species:Saccharomyces cerevisiae


Alignment Length:262 Identity:57/262 - (21%)
Similarity:108/262 - (41%) Gaps:63/262 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 QRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRR 86
            |..:.::|..||:....|.:|:..:|.||:.|.|||:.: |:.:.:.|:.:..|:.||.:...:.
Yeast     8 QLDRTTYYSILGLTSNATSSEVHKSYLKLARLLHPDKTK-SDKSEELFKAVVHAHSILTDEDQKL 71

  Fly    87 LYDKGI----VHTAGAQYAQDVH---------DVAEPVV-EDDA---ETKFYKSR-----FQKSR 129
            .||:.:    :||  .|..::.|         ..|.|.: :.:|   :.|.|:.:     ..|..
Yeast    72 RYDRDLKIKGLHT--YQPKKNCHIFKTKAKESQGASPTLGQSEAYHRQNKPYEQQPYGFGVGKKM 134

  Fly   130 VSDSAGRTPI---YDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNRIS-------GQTDM-- 182
            .|.|..:.||   ::...:.||||..|...|:......|  .:..|||..|       |:.|.  
Yeast   135 TSSSKSKVPIFKSFNLKSYQRNHYYSSKKERKHGSPDID--SLFHETNGASKVRMTDAGKMDTNS 197

  Fly   183 -------VLLAFIFAGVAVY-----------LMFLAESSYDTPKQKAKERYRRDQEEREQKLVGK 229
                   :|      |...|           .:..|.|.::..::..|::.::.|::::|:..|.
Yeast   198 QFQEIWEIL------GKNAYTHKSYSEDPNSCLGSALSDHEEEEEAGKQQQQQQQQQQQQQHYGM 256

  Fly   230 QS 231
            .|
Yeast   257 TS 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 17/62 (27%)
DnaJ 27..89 CDD:278647 17/61 (28%)
JJJ2NP_012373.2 DnaJ 13..74 CDD:395170 17/61 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_105154
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.710

Return to query results.
Submit another query.