DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT1G80030

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_565227.1 Gene:AT1G80030 / 844343 AraportID:AT1G80030 Length:500 Species:Arabidopsis thaliana


Alignment Length:147 Identity:49/147 - (33%)
Similarity:70/147 - (47%) Gaps:26/147 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 HYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQGSENAAKKFREINQAYEILGNYRLRRLYDK-- 90
            :|..||:.:.....||||||.:|:..||||.|: ...|.:||:||:.|||:|.:.:.|.|||:  
plant    76 YYATLGVSKSANNKEIKAAYRRLARQYHPDVNK-EPGATEKFKEISAAYEVLSDEQKRALYDQYG 139

  Fly    91 --GIVHTAG---AQYAQDVHDVAEPVV---------EDDAETKFYKSRFQKSRVSDSAGRTPIYD 141
              |:..|.|   ..|..:..|:.|...         .|.|:.    .|.::|||  :.|....||
plant   140 EAGVKSTVGGASGPYTSNPFDLFETFFGASMGGFPGMDQADF----GRTRRSRV--TKGEDLRYD 198

  Fly   142 FD-EWSRNHYG--KSFD 155
            .. |.|...:|  |.||
plant   199 ITLELSEAIFGSEKEFD 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 26/60 (43%)
DnaJ 27..89 CDD:278647 26/60 (43%)
AT1G80030NP_565227.1 PRK14293 74..436 CDD:237663 49/147 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.