DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT1G77930

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_565163.1 Gene:AT1G77930 / 844128 AraportID:AT1G77930 Length:271 Species:Arabidopsis thaliana


Alignment Length:193 Identity:48/193 - (24%)
Similarity:75/193 - (38%) Gaps:27/193 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LWRPL----LLLRGLYLSQRHQMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDRNQG------S 62
            ||..|    .|:|....||  :.|.||.|.:.|...:.:||.||.:|:..||||...|      .
plant    55 LWFRLNQRKTLVRASNWSQ--EKSPYDTLELDRNAEEEQIKVAYRRLAKFYHPDVYDGKGTLEEG 117

  Fly    63 ENAAKKFREINQAYEILGNYRLRRLYD-KGIVHTAGAQYA--------QDVHD------VAEPVV 112
            |.|..:|.:|..|||:|.:...:..|| ...|:...|..|        :...|      ||....
plant   118 ETAEARFIKIQAAYELLMDSEKKVQYDMDNRVNPMKASQAWMEWLMKKRKAFDQRGDMAVAAWAE 182

  Fly   113 EDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNHYGKSFDRRQAAQAKYDRIKVQRETNR 175
            :...:......|..:|:|.....|..:....:.||..:..:..|......|.|.::.:.|.::
plant   183 QQQLDINLRARRLSRSKVDPEEERKILEKEKKASRELFNSTLKRHTLVLKKRDLMRKKAEEDK 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 23/68 (34%)
DnaJ 27..89 CDD:278647 23/67 (34%)
AT1G77930NP_565163.1 DnaJ 76..144 CDD:278647 23/67 (34%)
DnaJ 78..>145 CDD:223560 23/66 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.