DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11035 and AT1G71000

DIOPT Version :9

Sequence 1:NP_001303469.1 Gene:CG11035 / 40953 FlyBaseID:FBgn0037544 Length:231 Species:Drosophila melanogaster
Sequence 2:NP_177256.4 Gene:AT1G71000 / 843439 AraportID:AT1G71000 Length:165 Species:Arabidopsis thaliana


Alignment Length:185 Identity:44/185 - (23%)
Similarity:83/185 - (44%) Gaps:30/185 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 QMSHYDALGIRRQCTQNEIKAAYYKLSMLYHPDR----NQGSENAAKKFREINQAYEILGNYRLR 85
            :.::|:.||:....:..:|:.||:||:.::||||    ...|..|.::|::|.:||.:|.:.|.|
plant     6 RQTYYEILGVAVDSSAEQIRRAYHKLAKIWHPDRWTKDPFRSGEAKRRFQQIQEAYSVLSDERKR 70

  Fly    86 RLYDKGIVHTAGAQ-YAQDVHDVAEPVVEDDAETKFYKSRFQKSRVSDSAGRTPIYDFDEWSRNH 149
            ..||.|:..:...: |...|.::...:.:...|.|.|.....::.|.|.     :|:|.      
plant    71 SSYDVGLYDSGEDEGYFDFVQEMVSLMSQTKREEKQYSLEELQTMVDDM-----VYEFQ------ 124

  Fly   150 YGKSFDRRQAAQAKYDRIKVQRETNRISGQTDMVLLAFIFAGVAVYLMFLAESSY 204
             .:...:.|:.|..:|    ..:|.....|..:.|.:|         .|.::|||
plant   125 -SEPLFQNQSMQMNFD----LNQTPDWHSQMSLPLSSF---------EFYSQSSY 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11035NP_001303469.1 DnaJ 26..>89 CDD:223560 21/66 (32%)
DnaJ 27..89 CDD:278647 21/65 (32%)
AT1G71000NP_177256.4 DnaJ 8..74 CDD:395170 21/65 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0714
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 54 1.000 Inparanoid score I2608
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.